PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 268aa    MW: 28806.3 Da    PI: 8.8428
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01821.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.73.1e-294597357
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                     +rY+eCl+NhAa+lGgh+vDGCgEfmp  g+    +alkCaACgCHR+FHR++ 
  Pahal.C01821.1 45 VARYHECLRNHAAALGGHVVDGCGEFMPGAGA--GDDALKCAACGCHRSFHRKDD 97
                    579*************************8555..589****************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-184696IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-254696IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.5E-254796IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.314896IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.3E-30173239IPR009057Homeodomain-like
SuperFamilySSF466895.24E-19175239IPR009057Homeodomain-like
TIGRFAMsTIGR015656.5E-27181237IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEFRGQEEPA EGMGASSAPP VAPSRAAPAP ATAPPPGNHA APPEVARYHE CLRNHAAALG  60
GHVVDGCGEF MPGAGAGDDA LKCAACGCHR SFHRKDDGQR RQLLLPAPAP PVTPTAPHVP  120
LLLPPPHPYA SASHPHYAPP PPPLPYLGTP SGSGGTTTES SSEERGAPSA HAAAAQGHLR  180
RKRFRTKFTP EQKEQMLAFA ERLGWRMQKQ DEALVQQFCE QVGVRRQVFK VWMHNNKHTG  240
SASRRQPQLP PQEQQSQQQP QPQQQQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-281822431879ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849211e-161KF184921.1 Saccharum hybrid cultivar R570 clone BAC 078K12 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961117.11e-118PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotB8AX537e-89ZHD6_ORYSI; Zinc-finger homeodomain protein 6
TrEMBLK7VTF42e-97K7VTF4_MAIZE; Uncharacterized protein
STRINGGRMZM2G328438_P016e-97(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.11e-38zinc finger homeodomain 1